PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015871693.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 590aa    MW: 64401.6 Da    PI: 4.8015
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015871693.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS454.19.1e-1392175821374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv+ Ll+cAeav++++l+la+al++++  las+++ +m+++a+yf+eALa+r++r    +y    p++  +++ s+ l++   f+e++P+lkf+h
  XP_015871693.1 217 LVHSLLACAEAVQQENLKLADALVKHIGLLASSQAGAMRKVATYFAEALARRIYR----IY----PQDCLDSSYSDLLQM--HFYETCPYLKFAH 301
                     689****************************************************....44....444443335555444..5************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +taNqaIlea+++++rvH++Df+++qG+QWpaL+qaLa R++gpp +R+Tg+g+p+++++++l+++g +La++Ae++gv+fef+ +vak+l+dle
  XP_015871693.1 302 FTANQAILEAFATADRVHVVDFGLKQGMQWPALMQALALRAGGPPAFRLTGIGPPQPDNTDALQQVGLKLAQLAETVGVEFEFRGFVAKSLADLE 396
                     *********************************************************************************************** PP

            GRAS 191 leeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres...e 280
                     + +L+++p   EalaVn+v++lhrll++++++e+    vL+ +k ++Pk+v+vveqea+hn++ Fl+rf+e+l+yys lfdsle++  +     +
  XP_015871693.1 397 PGMLDIRPadVEALAVNSVFELHRLLARPGAIEK----VLSSIKAMKPKIVTVVEQEASHNGPVFLDRFTESLHYYSNLFDSLESSSTTGLappS 487
                     ********999***********************....*********************************************887443335779 PP

            GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++  +++++lgr+i+nvvaceg er+erhetl +Wr+rl++aGF pv+l+++a kqa++ll+ ++ +dgyrvee++g+l+lgW++rpL+++SaW+
  XP_015871693.1 488 QDLIMSEVYLGRQICNVVACEGPERFERHETLTQWRARLGSAGFDPVHLGSNAFKQASMLLALFAgGDGYRVEENNGCLMLGWHTRPLIATSAWQ 582
                     999*******************************************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.1E-3539105IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011292.6E-3739111No hitNo description
PROSITE profilePS5098568.048191561IPR005202Transcription factor GRAS
PfamPF035143.1E-136217582IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MKRDYQDGCG SGGGSSNSVP VGKTKLWDEE QQEPGGAMDE LLAVLGYKVR ASDMAEVAQK  60
LEQLEMVMGS AQEDGISHLS DTVHYNPSDL SGWVQTMLTE LNTQPIDDES LLAPAESSTL  120
TSFDFSNSHH QIENQSRMVY NDDSEYDLRA IPGVAAFAPP QPQIESENTR KRLKTSIGST  180
SSSSPTPTQQ HVSVSVSGTE STRPMVLVDS QEAGVRLVHS LLACAEAVQQ ENLKLADALV  240
KHIGLLASSQ AGAMRKVATY FAEALARRIY RIYPQDCLDS SYSDLLQMHF YETCPYLKFA  300
HFTANQAILE AFATADRVHV VDFGLKQGMQ WPALMQALAL RAGGPPAFRL TGIGPPQPDN  360
TDALQQVGLK LAQLAETVGV EFEFRGFVAK SLADLEPGML DIRPADVEAL AVNSVFELHR  420
LLARPGAIEK VLSSIKAMKP KIVTVVEQEA SHNGPVFLDR FTESLHYYSN LFDSLESSST  480
TGLAPPSQDL IMSEVYLGRQ ICNVVACEGP ERFERHETLT QWRARLGSAG FDPVHLGSNA  540
FKQASMLLAL FAGGDGYRVE ENNGCLMLGW HTRPLIATSA WQLSESTQSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-532175824375GRAS family transcription factor containing p
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015871693.10.0PREDICTED: DELLA protein GAI-like isoform X1
RefseqXP_015872191.10.0PREDICTED: DELLA protein GAI-like isoform X1
SwissprotQ84TQ70.0GAI_GOSHI; DELLA protein GAI
TrEMBLA0A0D3LWI10.0A0A0D3LWI1_PRUMU; DELLA
STRINGVIT_14s0006g00640.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein